DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Mbl1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_034905.1 Gene:Mbl1 / 17194 MGIID:96923 Length:239 Species:Mus musculus


Alignment Length:183 Identity:40/183 - (21%)
Similarity:71/183 - (38%) Gaps:40/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 EMRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPK 237
            |.:||.:|.:.::|:..|:     ...||......:|.                           
Mouse    93 EEKLANMEAEIRILKSKLQ-----LTNKLHAFSMGKKS--------------------------- 125

  Fly   238 FERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSN 302
                |.:||..|| :...:......|.::.|.:|..::.||..||.......:: |||.|..:..
Mouse   126 ----GKKLFVTNH-EKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAF-LGITDEATEG 184

  Fly   303 TYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRSKM-NDDPCHRKKHVICQ 354
            .::.|..|| :.:.||...|||:....|:||.::.:.: ||..|......:|:
Mouse   185 QFMYVTGGR-LTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 9/55 (16%)
CLECT 247..354 CDD:153057 27/107 (25%)
Mbl1NP_034905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..88
Collagen <37..89 CDD:189968
CLECT_collectin_like 127..237 CDD:153061 30/113 (27%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000250|UniProtKB:P19999 203..211 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.