DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Cd209a

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_573501.1 Gene:Cd209a / 170786 MGIID:2157942 Length:238 Species:Mus musculus


Alignment Length:169 Identity:48/169 - (28%)
Similarity:71/169 - (42%) Gaps:22/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KIPEDFERKLQKLEQNQKDELTKL--GAQQSANQVTLKEIYTKVFWPKFERIGSRLFY-INHKDA 253
            |||...|...|   .|...|||:|  |..:........       |..|:  ||..|: :..|  
Mouse    77 KIPSSQEENNQ---MNVYQELTQLKAGVDRLCRSCPWD-------WTHFQ--GSCYFFSVAQK-- 127

  Fly   254 YDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSY-WLGINDLQSSNTYVSV-ASGREVEFL 316
             .|..:...|.::|..:..||..||.:.:......:.| |:|:.|:...:|:..| .|...:.|:
Mouse   128 -SWNDSATACHNVGAQLVVIKSDEEQNFLQQTSKKRGYTWMGLIDMSKESTWYWVDGSPLTLSFM 191

  Fly   317 N-WNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
            . |:.||||:..| |:|.|......||..|..||..||:
Mouse   192 KYWSKGEPNNLGE-EDCAEFRDDGWNDTKCTNKKFWICK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 11/38 (29%)
CLECT 247..354 CDD:153057 31/110 (28%)
Cd209aNP_573501.1 CLECT_DC-SIGN_like 108..230 CDD:153060 37/135 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.