Sequence 1: | NP_652641.1 | Gene: | lectin-24Db / 53550 | FlyBaseID: | FBgn0040102 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_570974.1 | Gene: | Cd209d / 170779 | MGIID: | 2157947 | Length: | 237 | Species: | Mus musculus |
Alignment Length: | 245 | Identity: | 52/245 - (21%) |
---|---|---|---|
Similarity: | 87/245 - (35%) | Gaps: | 76/245 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 168 MPINFEMRLAQI---EEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLG-------AQQSAN 222
Fly 223 QVTLK------------------------EIYTKVF---------------------WPKFERIG 242
Fly 243 SRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKS-YWLGINDLQSSNTYVS 306
Fly 307 V-ASGREVEFLN-WNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-24Db | NP_652641.1 | ExsD | <44..>156 | CDD:293411 | |
NAT_SF | <170..>229 | CDD:302625 | 15/92 (16%) | ||
CLECT | 247..354 | CDD:153057 | 28/109 (26%) | ||
Cd209d | NP_570974.1 | CLECT_DC-SIGN_like | 106..228 | CDD:153060 | 34/127 (27%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |