DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CLEC4C

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001358319.1 Gene:CLEC4C / 170482 HGNCID:13258 Length:213 Species:Homo sapiens


Alignment Length:132 Identity:40/132 - (30%)
Similarity:57/132 - (43%) Gaps:17/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 WPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLD-DKSYWLGINDL 298
            |..|:   |..::|: .....|..:...|..||..:..|..:||.|.|...|. :.||:||::|.
Human    87 WTSFQ---SSCYFIS-TGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDP 147

  Fly   299 QSSNTYVSVAS---GREVEFLNWNAGEPNHGNEDENCVEL-IRSK----MNDDPCHRKKHVICQT 355
            .....:..|..   ...|.|  |::||||  |.||.|..: .||.    .||..||..:..||:.
Human   148 GGRRHWQWVDQTPYNENVTF--WHSGEPN--NLDERCAIINFRSSEEWGWNDIHCHVPQKSICKM 208

  Fly   356 DK 357
            .|
Human   209 KK 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 35/115 (30%)
CLEC4CNP_001358319.1 CLECT_DC-SIGN_like 83..208 CDD:153060 39/128 (30%)
Carbohydrate binding. /evidence=ECO:0000269|PubMed:25995448, ECO:0007744|PDB:4ZET 184..186 0/1 (0%)