DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Klra9

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_034781.2 Gene:Klra9 / 16640 MGIID:1321153 Length:266 Species:Mus musculus


Alignment Length:314 Identity:56/314 - (17%)
Similarity:118/314 - (37%) Gaps:78/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LDHIVKHQEQWNTSEALWLNETQGKLD------RIQTQLAAQALSLEESAQKVPGDIKDRLDRME 111
            |..:|:|:            ||||..:      .:..||..:||.:                   
Mouse    19 LQKLVRHE------------ETQGPREAGNRKCSVSWQLIVKALGI------------------- 52

  Fly   112 HLQTTLQESLKKMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRL 176
                 |...|..:.|.|..::.:....::.:.:.|.:..|.:.             |..:|.:: 
Mouse    53 -----LCFLLLVIVAVLTIKIFQYSQHKQEINETLNHYHNCSN-------------MQSDFNLK- 98

  Fly   177 AQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERI 241
                 ::.|..:::...|.:......|.||::.:..||.....|.:  |.:.:   ..|..:   
Mouse    99 -----EEMLTNKSIDCRPSNELLDYIKREQDRWNSETKTVLDSSRD--TGRGV---KHWFCY--- 150

  Fly   242 GSRLFY-INHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYV 305
            |::.:| |.:|..  |......|:.....|..|:|::||..:...:..:|||:|::..:....:.
Mouse   151 GTKCYYFIMNKTT--WSGCKANCQHYSVPIVKIEDEDELKFLQRHVIPESYWIGLSYDKKKKEWA 213

  Fly   306 SVASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVIC--QTDK 357
            .:.:|:..  |:....:.|.  :...||.|.::::.|..|:...:.||  :.||
Mouse   214 WIDNGQSK--LDMKTRKMNF--KSRGCVFLSKARIEDTDCNIPYYCICGKKLDK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 17/108 (16%)
NAT_SF <170..>229 CDD:302625 10/58 (17%)
CLECT 247..354 CDD:153057 24/109 (22%)
Klra9NP_034781.2 Ly49 40..157 CDD:400616 23/167 (14%)
CLECT_NK_receptors_like 145..259 CDD:153063 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.