DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Klra4

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001239506.1 Gene:Klra4 / 16635 MGIID:101904 Length:263 Species:Mus musculus


Alignment Length:265 Identity:50/265 - (18%)
Similarity:98/265 - (36%) Gaps:66/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 KTLGDQLENQINLTKESQQDQL-------EALKNAMPINFEMRLA----------QIEEQQKLLQ 187
            |:.|.|.|.::..|::.::.:|       :.:..|:.|...:||.          |..:|:..|:
Mouse    15 KSSGLQNEMRLKETRKPEKARLRVCSVPWQLIVIALGILISLRLVTVAVLMTNIFQYGQQKHELK 79

  Fly   188 ETLKKIPEDFERKLQKLEQNQKDELTK-----------LGAQQS----ANQVTLKEIY-----TK 232
            |.||   ......:.:.:.|.||||.|           |...|:    ..:..|..:.     .|
Mouse    80 EFLK---HHNNCSIMQSDINLKDELLKNKSIECNLLESLNRDQNILCDKTRTVLDYLQHTGRGVK 141

  Fly   233 VFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGIND 297
            |:|..:   |.:.:|. ..|...|......|::....:..|.|::||..:...:...|.|:|::.
Mouse   142 VYWFCY---GMKCYYF-VMDRKPWSRCKQSCQNSSLTLLKIDDEDELKFLQLVVPSDSCWIGLSY 202

  Fly   298 LQSSNTYVSVASGREVEFLNWNAGEPN--------HGNEDENCVELIRSKMNDDPCHRKKHVIC- 353
            ......:.            |....|:        :...|..|:.|.:::::::.|.:....|| 
Mouse   203 DNKKKDWA------------WIDNRPSKLALNTTKYNIRDGGCMFLSKTRLDNNYCDQSFICICG 255

  Fly   354 -QTDK 357
             :.||
Mouse   256 KRLDK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 5/15 (33%)
NAT_SF <170..>229 CDD:302625 18/83 (22%)
CLECT 247..354 CDD:153057 19/116 (16%)
Klra4NP_001239506.1 Ly49 40..154 CDD:369850 23/119 (19%)
CLECT_NK_receptors_like 143..256 CDD:153063 21/128 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.