DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CLEC4F

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_011530937.1 Gene:CLEC4F / 165530 HGNCID:25357 Length:699 Species:Homo sapiens


Alignment Length:310 Identity:64/310 - (20%)
Similarity:113/310 - (36%) Gaps:86/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HIVKHQEQWNTSEALWLNETQGKLDRIQTQLAA------QALSLEESAQKVPGDIKDRLDRMEHL 113
            |::|...:..|::.   .:..|:||:..||:..      ...:|....|.:.|.:|:....::  
Human   442 HVLKRDLKMVTAQT---QKANGRLDQTDTQIQVFKSEMENVNTLNAQIQVLNGHMKNASREIQ-- 501

  Fly   114 QTTLQESLKKMPA------ELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINF 172
              ||::.:|...|      .||:.|.|...:.:.|...|||...||.|.||:| ..||.      
Human   502 --TLKQGMKNASALTSQTQMLDSNLQKASAEIQRLRGDLENTKALTMEIQQEQ-SRLK
T------ 557

  Fly   173 EMRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPK 237
               |..:...|:.||.|..::       ||.:.|.                           | |
Human   558 ---LHVVITSQEQLQRTQSQL-------LQMVLQG---------------------------W-K 584

  Fly   238 FERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSN 302
            |.  |..|:|.:.... .|..|..||...|.::|::..:||...:........||:|:.|..:..
Human   585 FN--GGSLYYFSSVKK-SWHEAEQFCVSQGAHLASVASKEEQAFLVEFTSKVYYWIGLTDRGTEG 646

  Fly   303 TYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVI 352
            ::            .|..|.|.:..::       ::..:...|..:|::|
Human   647 SW------------RWTDGTPFNAAQN-------KAPGSKGSCPLRKYII 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 26/112 (23%)
NAT_SF <170..>229 CDD:302625 8/58 (14%)
CLECT 247..354 CDD:153057 19/106 (18%)
CLEC4FXP_011530937.1 Lebercilin 374..556 CDD:292252 30/121 (25%)
CLECT_DC-SIGN_like 581..>657 CDD:153060 22/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.