DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and LOC1278406

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_317998.3 Gene:LOC1278406 / 1278406 VectorBaseID:AGAMI1_007520 Length:193 Species:Anopheles gambiae


Alignment Length:104 Identity:30/104 - (28%)
Similarity:46/104 - (44%) Gaps:23/104 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YINHKDAYDWQSAVDFCRDMGGYIAAIKDQEEL----DAISARLD-DKSYWL-GINDLQSSNTY- 304
            |..|.:..::..|.:.|||||...|:|::.::.    ||:....: :.::|| |.|....||.| 
Mosquito    67 YTLHTEVVNFFEAWNRCRDMGKQFASIENSQDFAAYRDAVQPYANVNYTFWLAGTNVGARSNDYR 131

  Fly   305 ----------VSVASGREVEFLNWNAGEPNHGNEDENCV 333
                      ||..||    |.||..|.|  .|:...|:
Mosquito   132 KFYWITNDRPVSYVSG----FQNWFLGSP--PNDANACM 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 30/104 (29%)
LOC1278406XP_317998.3 CLECT 61..188 CDD:214480 30/104 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.