DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and LOC1276921

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_061507943.1 Gene:LOC1276921 / 1276921 VectorBaseID:AGAMI1_011797 Length:472 Species:Anopheles gambiae


Alignment Length:129 Identity:31/129 - (24%)
Similarity:54/129 - (41%) Gaps:14/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEE------LDAISARLDDKSYWLG 294
            |||..|.:..:||: .:..:|..|...|:|....:|.....|:      |..:..|.|   .|:|
Mosquito    43 PKFTSISNECYYIS-PNKLNWLDAYFECKDHNSKLAEPMMYEDKVLRRTLQKMGLRED---LWIG 103

  Fly   295 INDLQSSNTYVSVASGREVEFLNWNAGEPNHGNE-DENCVEL---IRSKMNDDPCHRKKHVICQ 354
            .|.......:....:|||:|:.:::...|....: ..:|..|   |:.:.:...|..|.:.|||
Mosquito   104 GNYNWKLKKWQWGHNGREIEYQSFSQMVPRSSQDLTFHCALLKADIKFRWSAAACTDKMNYICQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 25/116 (22%)
LOC1276921XP_061507943.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.