DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CLEC10A

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_011521915.1 Gene:CLEC10A / 10462 HGNCID:16916 Length:319 Species:Homo sapiens


Alignment Length:259 Identity:62/259 - (23%)
Similarity:108/259 - (41%) Gaps:51/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 TTLQESLKKMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKN-AMPINFEMRLAQ 178
            ::|:|::..:.||::.  .|.|.|    ....|.|.:.|:::.........: .:|::.||.|  
Human    95 SSLEETIASLKAEVEG--FKQERQ----AGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLL-- 151

  Fly   179 IEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGS 243
              ..|:|:|: |||:    ..::..|..|.::..|: |.....|.|   |.....:|  |...| 
Human   152 --RVQQLVQD-LKKL----TCQVATLNNNGEEASTE-GTCCPVNWV---EHQDSCYW--FSHSG- 202

  Fly   244 RLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYV--- 305
                      ..|..|..:|:....::..|..:||.:.:...|.....|:|::|.:.:..:|   
Human   203 ----------MSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGT 257

  Fly   306 SVASGREVEFLNWNAGEPN----HG-NEDENCVEL-IRSKMNDDPCHRKKHVIC-----QTDKE 358
            ..|:|    |.||..|:|:    || ...|:|... ...:.|||.|.|..|.:|     ||.:|
Human   258 DYATG----FQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 10/40 (25%)
NAT_SF <170..>229 CDD:302625 15/58 (26%)
CLECT 247..354 CDD:153057 29/120 (24%)
CLEC10AXP_011521915.1 Lectin_N 18..170 CDD:281887 20/89 (22%)
CLECT_DC-SIGN_like 184..308 CDD:153060 34/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5380
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.