DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and LOC101886537

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_021327322.1 Gene:LOC101886537 / 101886537 -ID:- Length:284 Species:Danio rerio


Alignment Length:308 Identity:67/308 - (21%)
Similarity:115/308 - (37%) Gaps:101/308 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TSEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELD 129
            |:.::.||:...|:.:::.::.:.|.|..                   |.::.|:.:|::..:| 
Zfish    56 TAVSITLNQQYSKMTKVENKVVSLASSFA-------------------LLSSNQQEMKQLYGKL- 100

  Fly   130 ARLMKMENQQKTLGDQLENQI-NLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKI 193
                          .::.|:: |||.                .|.:..:..:|:...|.|.:.::
Zfish   101 --------------TEVGNEVANLTS----------------GFALLSSDQQERNDRLMEMVNEL 135

  Fly   194 PEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIY----TKVFWPKFER----IGSRLFYINH 250
            ..|.|.::..|.|.:.....|.|.|.     .|...|    ||:.|||...    |.|.|..:.:
Zfish   136 KADLETRIANLTQYKPVLRCKAGWQH-----FLSNCYLIPSTKLTWPKARSYCNGIDSLLLILGN 195

  Fly   251 KDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSS-------NTYVSVA 308
             |:.:|...|.:                     |.|..:|||:|:.||.:|       ..||..:
Zfish   196 -DSREWDYFVQY---------------------AILTSESYWIGLTDLITSQWRWIDGKPYVMNS 238

  Fly   309 SGREVEFLNWNAGEPNHGNEDENCVELIRS-KMNDDPCHRKKHVICQT 355
            |       :|..||||.....|:|.||..| |:||..|.:....||:|
Zfish   239 S-------HWEPGEPNDVLNKEDCGELTASGKLNDAQCSKSFQFICKT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 14/91 (15%)
NAT_SF <170..>229 CDD:302625 12/58 (21%)
CLECT 247..354 CDD:153057 30/114 (26%)
LOC101886537XP_021327322.1 CLECT_DC-SIGN_like 155..279 CDD:153060 44/157 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.