DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and si:ch73-111e15.1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_005172686.1 Gene:si:ch73-111e15.1 / 101885260 ZFINID:ZDB-GENE-110411-28 Length:271 Species:Danio rerio


Alignment Length:193 Identity:41/193 - (21%)
Similarity:74/193 - (38%) Gaps:44/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 EEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSR 244
            ||:.:||            .|:..|.:|:.:.||.:.......:..:::......|..|:   |.
Zfish    97 EERHQLL------------TKITNLTENKDELLTNIENLLKDREQLIQQHQIIAGWTYFQ---SS 146

  Fly   245 LFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSV-- 307
            .:|::: ::..|..:...|:.....:..|.:::|.|.:.....:|.:|:|:.|.:....:..|  
Zfish   147 FYYLSN-ESKSWTDSRGDCKGRKADLITINNRQEQDFVMTLTRNKEFWIGLTDSEKEGQWKWVDG 210

  Fly   308 --------ASGREVEFLNWNAGEPNHGNEDENCV--------ELIRSKMNDDPCHRKKHVICQ 354
                    ||.|.:.       |||.|.. ||||        |||  ...|..|......||:
Zfish   211 STLTTGFWASFRSIT-------EPNGGTR-ENCVLTHLKRHPELI--GWIDHNCDASYQWICE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 9/48 (19%)
CLECT 247..354 CDD:153057 28/124 (23%)
si:ch73-111e15.1XP_005172686.1 CLECT_DC-SIGN_like 139..264 CDD:153060 32/139 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.