Sequence 1: | NP_652641.1 | Gene: | lectin-24Db / 53550 | FlyBaseID: | FBgn0040102 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005155331.2 | Gene: | si:ch73-122g19.1 / 101884707 | ZFINID: | ZDB-GENE-110411-239 | Length: | 337 | Species: | Danio rerio |
Alignment Length: | 281 | Identity: | 63/281 - (22%) |
---|---|---|---|
Similarity: | 105/281 - (37%) | Gaps: | 86/281 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 ELDARLMKMENQQKTLGDQLE--------------------------------NQINLTKESQQ- 158
Fly 159 ------DQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGA 217
Fly 218 QQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAI 282
Fly 283 SARLDDKSYWLGINDLQSSNTYVSV---ASGREVEFLNWNAG--EPNHGNEDENCVELIRSKMND 342
Fly 343 DP---------CHRKKHVICQ 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-24Db | NP_652641.1 | ExsD | <44..>156 | CDD:293411 | 10/60 (17%) |
NAT_SF | <170..>229 | CDD:302625 | 12/58 (21%) | ||
CLECT | 247..354 | CDD:153057 | 31/120 (26%) | ||
si:ch73-122g19.1 | XP_005155331.2 | CLECT_DC-SIGN_like | 203..331 | CDD:153060 | 34/136 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 64 | 1.000 | Inparanoid score | I5368 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.060 |