DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and si:ch73-122g19.1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_005155331.2 Gene:si:ch73-122g19.1 / 101884707 ZFINID:ZDB-GENE-110411-239 Length:337 Species:Danio rerio


Alignment Length:281 Identity:63/281 - (22%)
Similarity:105/281 - (37%) Gaps:86/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ELDARLMKMENQQKTLGDQLE--------------------------------NQINLTKESQQ- 158
            |::...|::::.:.| |:.||                                |.||.|:|.:| 
Zfish    83 EINDNTMRIQSSELT-GNDLERMKSFRAALVCLILLCVLLLTAVLVLSVFIYTNSINYTEERRQL 146

  Fly   159 ------DQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGA 217
                  |:.:.|.|...:.        |:..:|||.....:             |:.|:| |...
Zfish   147 LTNITEDRAKLLTNITNLT--------EKSNQLLQNNTNLL-------------NETDQL-KWKK 189

  Fly   218 QQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAI 282
            :...||  ||:|.|...|    ......||.....:..|..:...|...|..:..|.:|:|.|.:
Zfish   190 ENLLNQ--LKKILTGDGW----TYNQSSFYYKSNISKTWIVSRSDCIARGADLIIINNQQEQDFV 248

  Fly   283 SARLDDKSYWLGINDLQSSNTYVSV---ASGREVEFLNWNAG--EPNHGNEDENCVELIRSKMND 342
            ..:.:..:.|:|:||:....|:..|   |...::.|  |.:|  ||| |:.:|||| :...|:.:
Zfish   249 MRKSNVAAVWIGLNDIIVEGTWRWVDGSAMKNDLSF--WASGSNEPN-GDTNENCV-VSADKVTE 309

  Fly   343 DP---------CHRKKHVICQ 354
            .|         |.|....||:
Zfish   310 WPYTSGWSDVSCERTFQWICE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 10/60 (17%)
NAT_SF <170..>229 CDD:302625 12/58 (21%)
CLECT 247..354 CDD:153057 31/120 (26%)
si:ch73-122g19.1XP_005155331.2 CLECT_DC-SIGN_like 203..331 CDD:153060 34/136 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.