DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and zmp:0000000924

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_021327939.1 Gene:zmp:0000000924 / 101884643 ZFINID:ZDB-GENE-130530-927 Length:276 Species:Danio rerio


Alignment Length:155 Identity:38/155 - (24%)
Similarity:59/155 - (38%) Gaps:38/155 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 KDELTKLGAQQSANQVTLKEIYTK---VFWPKF--ERIG----SRLFYINHKDAYDWQSAVDFCR 264
            |||||.|             :|.|   :.|.:.  :..|    ...||....:...|..:..:||
Zfish   124 KDELTNL-------------LYDKDQLIKWLQIFGQEAGWFYYQSSFYYFSNETKSWTESRRYCR 175

  Fly   265 DMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGREVEFLNW----NAGEPNH 325
            |....:..|.:::|.|.|.....:..:|:|:.|::...|:..| .|..:....|    :..||| 
Zfish   176 DKRADLIIINNKQEQDFIMKITCNNEFWIGLTDIKKEGTWKWV-DGSILTSGFWASSGSINEPN- 238

  Fly   326 GNEDENCVELIRSKMNDDPCHRKKH 350
            |.:.|||.          ..|.|||
Zfish   239 GGKTENCA----------VTHLKKH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 6/19 (32%)
CLECT 247..354 CDD:153057 27/108 (25%)
zmp:0000000924XP_021327939.1 CLECT_DC-SIGN_like 146..274 CDD:153060 29/120 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.