DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and LOC101884526

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_009303560.1 Gene:LOC101884526 / 101884526 -ID:- Length:269 Species:Danio rerio


Alignment Length:172 Identity:44/172 - (25%)
Similarity:77/172 - (44%) Gaps:13/172 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 ETLKKIPEDFERKLQKL-EQNQ--KDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYIN 249
            :|||:|.|:.:|.::.| |.|:  |:|..|:  .|...::. |:|.....|    |......|..
Zfish   103 KTLKQIKENLQRVIKNLAESNKALKEENPKI--HQKVEELR-KQINKMDGW----RCNQSSLYFI 160

  Fly   250 HKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLD-DKSYWLGINDLQSSNTYVSVASGREV 313
            ..:..:|..:...|::.|..:..|:.:||.:.:...:. ..|.|:|:.|.:...|:..| :|..:
Zfish   161 SSEKKNWTESRRDCKERGADLIIIESKEEQEFVEREIGVSDSVWIGLTDSELEGTWTWV-NGTSL 224

  Fly   314 EFLNWNAGEPN-HGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
            ....|.||||: ....||:|...:.....|.||......||:
Zfish   225 SPGFWGAGEPSGTSTNDEDCAVNLPLGFGDYPCKNTFKWICE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 14/43 (33%)
CLECT 247..354 CDD:153057 26/108 (24%)
LOC101884526XP_009303560.1 CLECT_DC-SIGN_like 148..267 CDD:153060 29/124 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.