DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and LOC101882781

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_005155516.1 Gene:LOC101882781 / 101882781 -ID:- Length:278 Species:Danio rerio


Alignment Length:312 Identity:67/312 - (21%)
Similarity:116/312 - (37%) Gaps:96/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EALWLN----ETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPA- 126
            ||::.|    :|:|.:| ::|.        .|..|  |..:...:.|....|..::|.|..:.| 
Zfish     8 EAIYQNINTKDTEGCVD-LKTH--------REKHQ--PPQLTGSVSRRNRKQRAVEECLGLLCAL 61

  Fly   127 -----------------ELDARLMKM-ENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFE 173
                             .|...:.|: |.|::.|.|   |:: ||:|  ::||....|       
Zfish    62 LLTAVIVICVCFSIQRKHLLTHITKLNEEQEQLLND---NKV-LTEE--REQLLKYNN------- 113

  Fly   174 MRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWP-- 236
                .:.|:::.:...:..:..:.||.|     |..::|||...|       |:....|: ||  
Zfish   114 ----DLSEEREQIFTNITNLKGERERLL-----NHNNDLTKERDQ-------LRNDKWKM-WPYE 161

  Fly   237 ------KFERI--GSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWL 293
                  ||..|  .:.|::|: .:...|..:...|:.....:|.||..|| .....::.|:::|:
Zfish   162 QDLPADKFRWICYNNSLYFIS-SEMKSWSDSRQDCQQRRADLAIIKSPEE-KTFFQKVVDRNFWI 224

  Fly   294 GI-----------------NDLQSSNTYVSVASGREVEFLNWNAG---EPNH 325
            |:                 :...|||..|..|.|......|.|.|   |..|
Zfish   225 GLTKTDVWKWLDGTVLTNGSKTDSSNCAVVAAGGYYTSACNSNNGWICEKTH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 24/111 (22%)
NAT_SF <170..>229 CDD:302625 10/58 (17%)
CLECT 247..354 CDD:153057 22/99 (22%)
LOC101882781XP_005155516.1 CLECT_NK_receptors_like 170..274 CDD:153063 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.