DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and si:dkey-187i8.2

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_021335897.1 Gene:si:dkey-187i8.2 / 101882603 ZFINID:ZDB-GENE-121214-181 Length:635 Species:Danio rerio


Alignment Length:356 Identity:81/356 - (22%)
Similarity:144/356 - (40%) Gaps:56/356 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLLDHIVKHQEQWNTSEALWLNETQGKLDRI 81
            |...|.|...||..|...:|       :.||      :.|...:|:    |.|..|.|  |:.:.
Zfish   315 LTREREELLANSTKVTRERD-------WLLS------ESIQSSKER----EELLANNT--KVTKE 360

  Fly    82 QTQLAAQALSLEESAQKVPGD----IKDRLD-------RMEHLQTTLQESLKKMPAELDARLMKM 135
            :..|.:::..|....::|..:    ||:| |       |:...:..|.::..|:..|.|..|.:.
Zfish   361 RDLLLSESTRLTREREEVLANNSNVIKER-DWLLSESIRLSKEREELLDNNTKVTRERDQLLSER 424

  Fly   136 ENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQ----IEEQQKLLQETLK--KIP 194
            .:..|...:.|.|..|:.||  :|::.:....:....|..:|.    .:|:.:|..|.::  |..
Zfish   425 FSLTKEREELLHNNSNVIKE--RDEIGSKSIQLKKETEELIANNTDLTKERDRLFSENIRLTKER 487

  Fly   195 EDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSA 259
            |:....:..|.: |:|:|||          ...|:.....|..|:   |.|::::.. ...|:.:
Zfish   488 EELSSNISDLIE-QRDQLTK----------EKTELSNMDGWVYFQ---SSLYFLSSL-TKSWEES 537

  Fly   260 VDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGREVE-FLNWNAGEP 323
            ...|...|..:..|.:.:|.:.::....|...|:|:.|::...|:..|...::.. |..|.:.||
Zfish   538 RKDCIARGADLVIINNGKEQEMVNMICGDVLVWIGLTDIEEEGTWKWVDGSKQTSGFRYWRSREP 602

  Fly   324 NHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
            | ||..||||........|..||.....||:
Zfish   603 N-GNRKENCVLTDAHGWIDHRCHEANKWICE 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 27/122 (22%)
NAT_SF <170..>229 CDD:302625 13/64 (20%)
CLECT 247..354 CDD:153057 26/107 (24%)
si:dkey-187i8.2XP_021335897.1 SMC_N <113..507 CDD:330553 49/224 (22%)
CLECT_DC-SIGN_like 515..633 CDD:153060 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.