DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CLEC3A

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_005743.5 Gene:CLEC3A / 10143 HGNCID:2052 Length:197 Species:Homo sapiens


Alignment Length:203 Identity:53/203 - (26%)
Similarity:87/203 - (42%) Gaps:59/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LLQETLK-----KIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIY---------TKVFW 235
            ||.:|..     |..:..:|:::..:.:.|.::.||..:.:|    ||||.         |||  
Human    16 LLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNA----LKEIQALQTVCLRGTKV-- 74

  Fly   236 PKFERIGSRLFYINHKDAY-------DWQSAVDFCRDMGGYIAAIKDQEELDAISARLDD----- 288
                          ||..|       .:..|.:.|...||.:...::.:|::|    |.|     
Human    75 --------------HKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINA----LQDYGKRS 121

  Fly   289 ----KSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCV---ELIRSKMNDDPCH 346
                ..:||||||:.:...:|.| :|..:.||||:..:|| |.:.||||   :..:.|.:|:.|.
Human   122 LPGVNDFWLGINDMVTEGKFVDV-NGIAISFLNWDRAQPN-GGKRENCVLFSQSAQGKWSDEACR 184

  Fly   347 RKKHVICQ 354
            ..|..||:
Human   185 SSKRYICE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 11/48 (23%)
CLECT 247..354 CDD:153057 36/125 (29%)
CLEC3ANP_005743.5 CLECT_tetranectin_like 68..193 CDD:153066 40/147 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.