DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and clec3bb

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_003200569.1 Gene:clec3bb / 100537161 ZFINID:ZDB-GENE-111027-16 Length:200 Species:Danio rerio


Alignment Length:184 Identity:50/184 - (27%)
Similarity:77/184 - (41%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 KKIPE--DFERK----LQKLEQNQKD---ELTKLGAQQSANQVTLK--EIYTKVFWPKFERIGSR 244
            ||.|:  |.|.:    |:.|:|...|   ||..|..||:...|.||  :|:.|.|...       
Zfish    31 KKTPDKKDSESRVSAALEDLQQQISDIVEELNLLKEQQALQTVCLKGTKIHGKCFLAD------- 88

  Fly   245 LFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEE--------LDAISARLDDKSYWLGINDLQSS 301
                :.|..|  .:|.:.|...||.:|......:        ..:|||   |...|||:||:|:.
Zfish    89 ----SMKKRY--HTANEDCIAKGGILATPLSSAQNTQLYEYMRQSISA---DAEIWLGVNDMQTE 144

  Fly   302 NTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIR-SKMNDDPCHRKKHVICQ 354
            ..:.. .:|..:.:.||...:|: |...:||..|.. .|..|:.|..::..||:
Zfish   145 GLWTD-QTGSAIRYKNWKLPQPD-GGSAQNCAVLTSGGKWLDESCREERASICE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 17/48 (35%)
CLECT 247..354 CDD:153057 29/115 (25%)
clec3bbXP_003200569.1 CLECT 74..197 CDD:295302 35/141 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.