DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and LOC100363064

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:180 Identity:40/180 - (22%)
Similarity:78/180 - (43%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 QKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDA-------YDWQ-- 257
            |..:|.....|.|:...|......|::|      .:.::|..:|...|...|       :||:  
  Rat   100 QTQDQKGSSSLGKVAVPQEQTHTGLEQI------QQIQQIQQQLTQFNASLAGLCRPCPWDWEFF 158

  Fly   258 ---------------SAVDFCRDMGGY---IAAIKDQEELDAISARLDDKSYWLGINDLQSSNTY 304
                           ::...|:|:|.:   |.::.:|..:...:.|.:.:| |:|::|.....::
  Rat   159 QGSCYLFSRTLASWGASASSCKDLGAHLVIINSVAEQRFMKYWNVRKNQRS-WIGLSDHLREGSW 222

  Fly   305 VSVASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
            ..| ....::|..|..||||: :.||:||||...:.||:.|.::...:|:
  Rat   223 QWV-DHSPLKFSFWKEGEPNN-DGDEDCVELFMDEWNDNTCTQQNFWVCE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 6/26 (23%)
CLECT 247..354 CDD:153057 30/133 (23%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 28/121 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.