DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and si:ch211-125e6.11

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001124136.1 Gene:si:ch211-125e6.11 / 100170830 ZFINID:ZDB-GENE-070912-35 Length:146 Species:Danio rerio


Alignment Length:103 Identity:26/103 - (25%)
Similarity:49/103 - (47%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 WQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKS-YWLGINDLQSSNTYVSVASGREVEFLNWN 319
            |.:|...|:..||.:|::.::.|.|.:...:...| .|:|.:|.:....:: ...|...::.||.
Zfish    43 WITAEKNCQGFGGNLASVHNRLENDFLMNMVPSSSRCWIGGHDGEQEGQWL-WTDGSMFDYNNWC 106

  Fly   320 AGEPNHGNEDENCVELIRSK---MNDDPCHRKKHVICQ 354
            :.|||: ...|||:|:..:.   .||..|......:|:
Zfish   107 SDEPNN-QRSENCMEINWTSNHCWNDQGCSTSMGFMCE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 25/101 (25%)
si:ch211-125e6.11NP_001124136.1 CLECT 32..144 CDD:153057 26/103 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.