DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and si:dkey-241l7.4

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001096098.2 Gene:si:dkey-241l7.4 / 100124601 ZFINID:ZDB-GENE-041014-238 Length:153 Species:Danio rerio


Alignment Length:116 Identity:31/116 - (26%)
Similarity:60/116 - (51%) Gaps:8/116 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 GSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKS-YWLGINDLQSSNTYV 305
            |||.|....: :.:|.:|...|:.:||.:|::.||.|.|.:.:.:...: .|:|.:|.:....::
Zfish    35 GSRCFRFFSR-SVNWVTAERNCQSLGGNLASVHDQVENDFLLSLVPGSTRCWIGGHDGEQDGQWL 98

  Fly   306 SVASGREVEFLNWNAGEPNHGNEDENCVELIRSK---MNDDPCHRKKHVIC 353
             .:.|....:.||.:|||:.|:  |:|:|:..:.   .||..|..:...:|
Zfish    99 -WSDGSVYGYTNWCSGEPSGGS--EHCLEINWTSNRCWNDQRCSTRMGYLC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 27/111 (24%)
si:dkey-241l7.4NP_001096098.2 CLECT 27..146 CDD:214480 30/114 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.