DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and si:ch211-214k5.3

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_009303575.2 Gene:si:ch211-214k5.3 / 100034611 ZFINID:ZDB-GENE-041210-206 Length:291 Species:Danio rerio


Alignment Length:259 Identity:58/259 - (22%)
Similarity:95/259 - (36%) Gaps:74/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HLQTTLQESLKKMPAELDARLMKMEN--QQKTLGDQL---------ENQINLTKESQQDQLEALK 165
            |...|.:..:..:..|.|..|:.:.|  :::   |||         :|| |||||         |
Zfish    87 HTNYTQENRITSLTEERDQLLINITNLIEER---DQLLININAGNAQNQ-NLTKE---------K 138

  Fly   166 NAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIY 230
            |.:          :.:...|:.:.:         :||::|.|.::...||..             
Zfish   139 NEL----------LSKNDDLIIQNV---------QLQQVENNLQECRNKLDG------------- 171

  Fly   231 TKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGI 295
                |..::    ..||....:..:|..:...|||.|..:..|.::||.|.:.........|:|:
Zfish   172 ----WFNYQ----SSFYFISSEKKNWSESTRNCRDRGADLIIINNKEEQDFVKKISGGDVVWIGL 228

  Fly   296 NDLQSSNTY-----VSVASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
            :|.....::     .|:.||    |..|...||| |...|||.....|...|.||:.....||:
Zfish   229 SDSDEEGSWKWVDDPSMTSG----FRFWGTFEPN-GKRGENCAVSRSSGWADYPCNNYFQWICE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 15/54 (28%)
NAT_SF <170..>229 CDD:302625 7/58 (12%)
CLECT 247..354 CDD:153057 30/111 (27%)
si:ch211-214k5.3XP_009303575.2 ATPgrasp_Ter 113..>187 CDD:330691 22/126 (17%)
CLECT_DC-SIGN_like 170..288 CDD:153060 33/144 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.