DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and mbl2

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_571645.2 Gene:mbl2 / 100008009 ZFINID:ZDB-GENE-000427-2 Length:251 Species:Danio rerio


Alignment Length:156 Identity:31/156 - (19%)
Similarity:68/156 - (43%) Gaps:12/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 LEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGG 268
            :..:.|.||.||     ::::.|  |...|.:..|:::|.: :|:.......:...:.:|...||
Zfish   103 MSDSLKSELQKL-----SDKIAL--IEKVVNFKTFKKVGQK-YYVTDDVEETFDKGMQYCSSNGG 159

  Fly   269 YIAAIKDQEELDAISARLDD--KSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDEN 331
            .:...:..||...:...:..  |..::.|.|.:....:|. ...:::.|.||...:|::....::
Zfish   160 ALVLPRTLEENALLKVFVSSAFKRLFIRITDREKEGEFVD-TDRKKLTFTNWGPNQPDNYKGAQD 223

  Fly   332 CVELIRSKMNDD-PCHRKKHVICQTD 356
            |..:..|.:.|| .|.....:||:.:
Zfish   224 CGAIADSGLWDDVSCDSLYPIICEIE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 6/24 (25%)
CLECT 247..354 CDD:153057 20/109 (18%)
mbl2NP_571645.2 CLECT_collectin_like 135..248 CDD:153061 21/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10963
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.