DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and hbl1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_009296948.2 Gene:hbl1 / 100007982 ZFINID:ZDB-GENE-070912-285 Length:297 Species:Danio rerio


Alignment Length:159 Identity:31/159 - (19%)
Similarity:70/159 - (44%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 QNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYI 270
            ::.|.|:..|.|:       :..|.....:..|.::|.: :|:..:....:.:.:..|....|.:
Zfish   148 ESLKSEIQNLKAK-------IDTIEKAASFSNFRKVGQK-YYVTDRIFGTFDNGIKLCESSSGTL 204

  Fly   271 AAIKDQEELDAI------SARLDDKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPN--HGN 327
            ...|...|..|:      |..:::|.| :|:.|.::...:|.: .|:::.|..|..|:|:  .|.
Zfish   205 VVPKSSAENQALVRVAASSGLINEKPY-IGVTDKETEGQFVDI-EGKQLTFTKWGPGQPDDYQGA 267

  Fly   328 EDENCVELIRSKMNDDPCHRKKHVICQTD 356
            :|...:: :....:|..|...:.:||:.|
Zfish   268 QDCGVID-VSGTWDDGNCGDIRPIICEID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 4/22 (18%)
CLECT 247..354 CDD:153057 22/114 (19%)
hbl1XP_009296948.2 CLECT 178..294 CDD:321932 23/119 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10963
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.