DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and si:ch211-125e6.14

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001104711.1 Gene:si:ch211-125e6.14 / 100002523 ZFINID:ZDB-GENE-070912-38 Length:149 Species:Danio rerio


Alignment Length:116 Identity:34/116 - (29%)
Similarity:58/116 - (50%) Gaps:6/116 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 GSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKS-YWLGINDLQSSNTYV 305
            |||.|.. ..::.||.:|...|:.:|..:|:|:|:.|.|.:.:.:.|.: .|:|.:|.:....::
Zfish    32 GSRCFKF-FSESVDWITAERNCQGLGTNLASIQDKVENDFLLSLVPDSTRCWVGGHDGEQEGQWL 95

  Fly   306 SVASGREVEFLNWNAGEPNHGNEDENCVELIRSK---MNDDPCHRKKHVIC 353
             ...|....:.||..||||:.|..|||:|:..:.   .||..|......:|
Zfish    96 -WTDGSVYNYTNWYPGEPNNNNGKENCLEINWTSNRCWNDQGCSTSMGYLC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 30/111 (27%)
si:ch211-125e6.14NP_001104711.1 CLECT 24..145 CDD:214480 33/114 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.