Sequence 1: | NP_652641.1 | Gene: | lectin-24Db / 53550 | FlyBaseID: | FBgn0040102 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107113.1 | Gene: | asgrl1 / 100000463 | ZFINID: | ZDB-GENE-081105-120 | Length: | 270 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 48/199 - (24%) |
---|---|---|---|
Similarity: | 83/199 - (41%) | Gaps: | 38/199 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 MRLAQIEEQ---QKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQ-QSANQVTLKEIYTKVF 234
Fly 235 WPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISA--RLDDKSYWLGIND 297
Fly 298 LQSSNTYVSVASGREVEFL--NWNAGEPNHGN---EDENCVEL-------IRSKMNDDPCHRKKH 350
Fly 351 VICQ 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-24Db | NP_652641.1 | ExsD | <44..>156 | CDD:293411 | |
NAT_SF | <170..>229 | CDD:302625 | 11/58 (19%) | ||
CLECT | 247..354 | CDD:153057 | 30/120 (25%) | ||
asgrl1 | NP_001107113.1 | CLECT_DC-SIGN_like | 134..264 | CDD:153060 | 36/141 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X73 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |