DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and asgrl1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001107113.1 Gene:asgrl1 / 100000463 ZFINID:ZDB-GENE-081105-120 Length:270 Species:Danio rerio


Alignment Length:199 Identity:48/199 - (24%)
Similarity:83/199 - (41%) Gaps:38/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 MRLAQIEEQ---QKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQ-QSANQVTLKEIYTKVF 234
            ::::||.::   .:|..:|....|        |..|.:....::|..| ..|.|...:|.:  ||
Zfish    86 IKISQISQEVADVRLYMKTFVDAP--------KTPQFENGHFSELVMQVPVAEQGPCQENW--VF 140

  Fly   235 WPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISA--RLDDKSYWLGIND 297
            :.     ||..|....|  .:|::|...|...|.::..:.|..|||.:|:  :|.| |||:|:  
Zfish   141 YK-----GSCYFQSTMK--RNWKTAESNCIQKGSHLVVVNDLAELDFLSSIVKLSD-SYWIGL-- 195

  Fly   298 LQSSNTYVSVASGREVEFL--NWNAGEPNHGN---EDENCVEL-------IRSKMNDDPCHRKKH 350
            ::......|...|.|....  :|:.|:|:..:   ..|:|.:|       .|...||..|.....
Zfish   196 VEKEEGQWSWVDGTEFSATEHHWDVGQPDDWDVRVNGEDCGQLHSREIVNRRRMWNDADCTLSYP 260

  Fly   351 VICQ 354
            .||:
Zfish   261 YICE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 11/58 (19%)
CLECT 247..354 CDD:153057 30/120 (25%)
asgrl1NP_001107113.1 CLECT_DC-SIGN_like 134..264 CDD:153060 36/141 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.