DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Clec4g

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:190 Identity:37/190 - (19%)
Similarity:78/190 - (41%) Gaps:48/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RLEMRLQSFQN------QMETKLRALKQQIEPYMENVKMSNK-IKMSVFKKI------------- 119
            :|:..|..|::      :.|:.|:.|::::...:.......: |:..:|:.:             
Mouse   101 QLQTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASRDRENIRSELFQALEAVKRQNSSCEQC 165

  Fly   120 --------GSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNE--IFSEETK-KKYWVDI 173
                    ||.:::.|.|  ..||:|...|...|.||..:   :.|||  ..|:.|: :.||:.:
Mouse   166 PPSWLPFQGSCYYFSETQ--ATWDTAQSYCGGQGAHLVIV---RGLNEQGFLSQHTRGRGYWLGL 225

  Fly   174 NSRAN----DGASWISTLSGRDVPFLKW---KPNLATNIHNHCVYINSNEMYFE-NCAND 225
            .:..:    .|..|:   .|..:.|..|   :||.:.. |..|:.:..:.::.: .|.|:
Mouse   226 RAVRHLNKIQGYRWV---DGASLNFSHWNSGEPNDSRG-HEDCIMMLHSGLWNDAPCTNE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 25/106 (24%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003 8/61 (13%)
CLECT 165..289 CDD:295302 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.