DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and lectin-22C

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:205 Identity:65/205 - (31%)
Similarity:101/205 - (49%) Gaps:37/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NSLRQNGTLWRIGNME---------------------QRLEMRLQSFQ---NQMETKLRALKQQI 98
            ||.:.|..|.|...||                     ::|.:..|:|.   |.||..|.||::.:
  Fly    63 NSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTV 127

  Fly    99 EPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEI--- 160
                  :::..|||...|::|||:::|:||..:..|.:|..|||.||||||:|.||.:|..|   
  Fly   128 ------LEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKAN 186

  Fly   161 FSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHN-HCVYINSNEMYFENCAN 224
            ..|:|  .||:.||...::| .::|..:|:...||||.....:.:.. :||::.:.|||...|..
  Fly   187 LKEDT--HYWLGINDLDHEG-KFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHY 248

  Fly   225 DNYFACQAEQ 234
            ...|.||.|:
  Fly   249 TFRFICQTEE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 36/103 (35%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 39/111 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
87.900

Return to query results.
Submit another query.