Sequence 1: | NP_652640.1 | Gene: | lectin-29Ca / 53547 | FlyBaseID: | FBgn0040098 | Length: | 236 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005270185.1 | Gene: | SFTPA2 / 729238 | HGNCID: | 10799 | Length: | 265 | Species: | Homo sapiens |
Alignment Length: | 213 | Identity: | 46/213 - (21%) |
---|---|---|---|
Similarity: | 76/213 - (35%) | Gaps: | 47/213 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 GTNELPKAP-MPYYTIENIDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRA 93
Fly 94 LKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELN 158
Fly 159 EIFSEETKK--KY-WVDINSRANDGASWISTLSGRDVPFLKW-KPNLATNIHNHCVYINSNEMYF 219
Fly 220 E------NCANDNYFACQ 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-29Ca | NP_652640.1 | CLECT | 131..231 | CDD:153057 | 25/109 (23%) |
SFTPA2 | XP_005270185.1 | Collagen | 45..117 | CDD:189968 | 9/39 (23%) |
CLECT_collectin_like | 153..265 | CDD:153061 | 27/125 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |