DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and CLEC3B

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_016862606.1 Gene:CLEC3B / 7123 HGNCID:11891 Length:209 Species:Homo sapiens


Alignment Length:245 Identity:44/245 - (17%)
Similarity:84/245 - (34%) Gaps:74/245 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NFWGVSAKKQDTSTGTNELPKAPMPYYTIENIDMH------QQHWFTYNSLRQNGTLWRIGNMEQ 74
            |.|| .|:.::..|     |::|:|       |..      .||:                    
Human     6 NLWG-QAQTENLWT-----PQSPLP-------DRRPLTTACAQHF-------------------- 37

  Fly    75 RLEMRLQSFQNQMETKLRALK---------QQIEPYMENV--KMSNKIKMSVFKKIGSRHFYLEK 128
             |...|||....:...|.||:         |.:|..:..:  ....|:.|..|         |..
Human    38 -LSSLLQSQLYPLSPTLPALRRTDPAKGTWQALEACLGCLVCLKGTKVHMKCF---------LAF 92

  Fly   129 QKKMPWDSAYDTCRQMGGHLANILDEKELNEIF-----SEETKKKYWVDINSRANDGASWISTLS 188
            .:...:..|.:.|...||.|.......|.:.::     |...:.:.|:.:|..|.:| :|:. ::
Human    93 TQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEG-TWVD-MT 155

  Fly   189 GRDVPFLKWKPNLATNIH----NHCVYIN--SNEMYFE-NCANDNYFACQ 231
            |..:.:..|:..:.....    .:|..::  :|..:|: .|.:...:.||
Human   156 GARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 18/111 (16%)
CLEC3BXP_016862606.1 CLECT_tetranectin_like 78..206 CDD:153066 24/139 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5471
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.