DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and hbl2

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_009296949.2 Gene:hbl2 / 566971 ZFINID:ZDB-GENE-070912-286 Length:253 Species:Danio rerio


Alignment Length:164 Identity:29/164 - (17%)
Similarity:63/164 - (38%) Gaps:23/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMG 145
            :|....::::::.||.:|:...:....||      |:::|.: :|:.......::.....|:..|
Zfish   101 ESVIESLKSEIQNLKAEIDTIEKAASFSN------FRRVGQK-YYVTDGILGNFNDGIKFCKDAG 158

  Fly   146 GHLA--------NILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLA 202
            |.|.        ..|....::...|  |.|.| :.:..|..:|.  ...:.|:.:.|..|.|...
Zfish   159 GTLVVPKTAAENQALVRVSVSSALS--TGKPY-IGVTDRETEGQ--FVDIEGKQLTFTNWGPGQP 218

  Fly   203 TNIH--NHCVYINSNEMYFE-NCANDNYFACQAE 233
            .:..  ..|..|..:..:.: ||.:.....|:.:
Zfish   219 DDYRGGQDCGVIEVSGTWDDGNCGDIRPIICEID 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 19/110 (17%)
hbl2XP_009296949.2 Collagen <36..70 CDD:189968
CLECT_collectin_like 135..251 CDD:153061 21/121 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.