DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and si:ch211-282j17.10

DIOPT Version :10

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001026840.1 Gene:si:ch211-282j17.10 / 557030 ZFINID:ZDB-GENE-041210-283 Length:368 Species:Danio rerio


Alignment Length:120 Identity:27/120 - (22%)
Similarity:48/120 - (40%) Gaps:9/120 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLA---NILDEKELNEIFSEETKKKYWVDINS 175
            |:.:.:..::.::.::|.......|  ||:....||   |:.|..||.:..:....:..|:.:..
Zfish    16 SISESVQHQYHFINEKKNCTEAQRY--CREKYKDLATVDNMNDTIELIKSVNNARVQNIWIGLQR 78

  Fly   176 RANDGASWISTLSGRDVPFLKWKPNLATNIHNHCVYINSNEMYFENCANDNYFAC 230
            .:.....|   .||..|.||.|....... :|.|..:|:.:...|.|.|...|.|
Zfish    79 TSVYKWHW---SSGDPVFFLNWTSEEPAG-NNECTVMNNGQWINEACNNTRVFVC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 25/103 (24%)
si:ch211-282j17.10NP_001026840.1 CLECT 24..131 CDD:470576 26/112 (23%)
CLECT_1 134..247 CDD:153072
CLECT 253..365 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.