DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and lectin-24Db

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:361 Identity:78/361 - (21%)
Similarity:129/361 - (35%) Gaps:131/361 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKYATCIFSIFALWNFWGVSAKKQDTSTGTNELPKAP-----------MPYYTIENIDMHQQHW 54
            |::...||..:....|.....|:..:.|.....|...|           .|  .:::|..||:.|
  Fly     1 MFRLEKCIVYLLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQP--LLDHIVKHQEQW 63

  Fly    55 FTYNSLRQN---GTLWRI-------------------GNMEQR---------------------L 76
            .|..:|..|   |.|.||                   |:::.|                     |
  Fly    64 NTSEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAEL 128

  Fly    77 EMRLQSFQNQMET------------------KLRALK---------------------------- 95
            :.||...:||.:|                  :|.|||                            
  Fly   129 DARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKI 193

  Fly    96 -QQIEPYMENVKMSNKIKMS-----------------------VFKKIGSRHFYLEKQKKMPWDS 136
             :..|..::.::.:.|.:::                       .|::||||.||:..:....|.|
  Fly   194 PEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQS 258

  Fly   137 AYDTCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKW---K 198
            |.|.||.|||::|.|.|::||:.|.:....|.||:.||...:.. :::|..|||:|.||.|   :
  Fly   259 AVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSN-TYVSVASGREVEFLNWNAGE 322

  Fly   199 PNLATNIHNHCVYINSNEMYFENCANDNYFACQAEQ 234
            ||.. |...:||.:..::|..:.|....:..||.::
  Fly   323 PNHG-NEDENCVELIRSKMNDDPCHRKKHVICQTDK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 35/102 (34%)
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 20/113 (18%)
NAT_SF <170..>229 CDD:302625 2/58 (3%)
CLECT 247..354 CDD:153057 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.