DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and lectin-28C

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster


Alignment Length:230 Identity:70/230 - (30%)
Similarity:113/230 - (49%) Gaps:44/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KAPMPYYTIENIDMHQQHWFT--------------------YNSLRQNGTLWR------IGNMEQ 74
            :|.||  .|.:|..||:.|.|                    ..||.::   |:      |.|...
  Fly    47 EALMP--LIGHIAQHQEQWKTCKLQEIQAQQRDIEKEIESQKTSLTES---WKKIIAEDIENRTN 106

  Fly    75 RLEMRLQSFQNQMETKLRALKQQIEPYMENVK-MSNKIK-MSVFKKIGSRHFYLEKQKKMPWDSA 137
            |.|::       ||.:|..|::.:.....::| ||.||. :..||:||||:.::|...:..|.||
  Fly   107 RSELK-------MEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSA 164

  Fly   138 YDTCRQMGGHLANILDEKELNEIFSEETK-KKYWVDINSRANDGASWISTLSGRDVPFLKWKPN- 200
            ...|::|||:||:|::|.:.|.|.|:.:| ..|.:.|:..|..|. :||..||:..|||||.|. 
  Fly   165 LSACQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGV-FISVSSGKRAPFLKWNPGE 228

  Fly   201 -LATNIHNHCVYINSNEMYFENCANDNYFACQAEQ 234
             |..::...||.|::..|:..:|.:|..:.|:|.:
  Fly   229 PLYEHVDQRCVSIHNGGMWVASCTSDFKYICEANE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 36/102 (35%)
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 21/98 (21%)
CLECT 160..260 CDD:153057 36/100 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.