DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and lectin-30A

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:240 Identity:86/240 - (35%)
Similarity:139/240 - (57%) Gaps:23/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKYATCIFSIFALWNFWGVSAKKQDTSTGTNELPKAPMPYYTIENIDMHQQHWFTYNSLRQNGT 65
            |:||  |...:...|....|.|.|.:.          |:   .|:.:.::||.|||:.:|:::..
  Fly     1 MFKY--CFICVILAWASRDVLANKTEN----------PL---LIDQVAINQQQWFTFIALKESEM 50

  Fly    66 LWRIGNMEQRLEMRLQSFQNQMETKLRALK-----QQIEPYMENVKMSNKIKMSVFKKIGSRHFY 125
            ..:|..:|:.:|.||.:.|:::...|..|:     |.:|. :|.:::|::|..::|:::|:|.||
  Fly    51 QQKIVRIERSIEERLMAMQSKLAYALNELQTIMGNQSVET-LEKLRISHRINPALFQRMGTRRFY 114

  Fly   126 LEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGR 190
            :||:.|..|..|.:||||:|||:|.|.||:|.|||||......:|:|:|:...:|. :.|:|:||
  Fly   115 IEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIFSRAPAGVFWIDMNAMFKNGL-FASSLTGR 178

  Fly   191 DVPFLKWKPNLATNIHNHCVYINSNEMYFENCANDNYFACQAEQW 235
            ..||.|||.....|..: ||.:.:.|||.|||.|.:.|.||||||
  Fly   179 SPPFFKWKKEERGNKFD-CVNVYNKEMYNENCFNTHLFICQAEQW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 44/99 (44%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 44/101 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448752
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
87.800

Return to query results.
Submit another query.