DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and acana

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_005166542.1 Gene:acana / 497505 ZFINID:ZDB-GENE-050208-221 Length:1547 Species:Danio rerio


Alignment Length:123 Identity:36/123 - (29%)
Similarity:51/123 - (41%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKKY-WVDINSRA--NDGASWIST 186
            ||...|:..|..|...||.:..||.:|...:|  :.|.....:.| |:.:|.:.  || ..|   
Zfish  1349 YLHFSKRETWLDAEQRCRDLNAHLVSINTPEE--QAFVNSNAQDYQWIGLNDKTVEND-FRW--- 1407

  Fly   187 LSGRDVPFLKWKPNLATNIHNHCVYINSNE-----MYFENCA-ND---NY---FACQA 232
            ..|..:.|..|:||...|      |.||.|     ::.||.. ||   ||   |.|::
Zfish  1408 SDGTQLQFENWRPNQPDN------YFNSEEDCVVMIWHENGQWNDVPCNYHLPFTCKS 1459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 32/114 (28%)
acanaXP_005166542.1 Ig 45..156 CDD:299845
Link_domain_CSPGs_modules_1_3 155..249 CDD:239594
Link_domain_CSPGs_modules_2_4 256..351 CDD:239597
Link_domain_CSPGs_modules_1_3 460..555 CDD:239594
Link_domain_CSPGs_modules_2_4 562..657 CDD:239597
EGF 1299..1329 CDD:278437
CLECT_CSPGs 1337..1460 CDD:153058 36/123 (29%)
CCP 1464..1521 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.