DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Clec3a

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001007224.1 Gene:Clec3a / 403395 MGIID:2685642 Length:196 Species:Mus musculus


Alignment Length:176 Identity:36/176 - (20%)
Similarity:67/176 - (38%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIK---------MSVFKKIGSRHFYLEKQK 130
            |::.|..| :.:::.|...||.|:|.....|....:::         ..|.||.     ||..:.
Mouse    26 RMKARKHS-KRRVKAKDDDLKSQVEKLWREVNALKEMQALQTVCLRGTKVHKKC-----YLASEG 84

  Fly   131 KMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKK------YWVDINSRANDGASWISTLSG 189
            ...:..|.:.|...||.|....:..|:|.: .:..|:.      :|:.||....:|.  ...:.|
Mouse    85 LKHYHEANEDCISKGGTLVVPRNSDEINAL-RDYGKRSLPGVNDFWLGINDMVTEGK--FLDVHG 146

  Fly   190 RDVPFLKW-KPNLATNIHNHCVYINSN---EMYFENCANDNYFACQ 231
            ..|.||.| :...:.....:||..:.:   :...|.|.:...:.|:
Mouse   147 FAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 21/109 (19%)
Clec3aNP_001007224.1 CLECT_tetranectin_like 68..193 CDD:153066 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5445
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.