DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and CLEC17A

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:215 Identity:51/215 - (23%)
Similarity:82/215 - (38%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QQHWFTYNSLRQNGTLW---------RIGNMEQRLEMRLQSFQNQMETK--------LRALKQQI 98
            |:.|..|..|....:|:         .|...|...|:|:.||| ||..:        |..||..|
Human   166 QKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQ-QMTWRTNMTGMAGLAGLKHDI 229

  Fly    99 EPYMENVKMSNKIKMSVFKKIGSRH--------------FYLEKQKKMPWDSAYDTCRQMGGHLA 149
            .....:   :|:..:.::..:..|.              :|.....| .||.|...|::...||.
Human   230 ARVRAD---TNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTK-SWDEARMFCQENYSHLV 290

  Fly   150 NILDEKELNEIF-SEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHNH-CVYI 212
            .|....|.|.:. :..:.:.||:.:|.||.:| .| ..|.|..|....|:|....|||:. |..:
Human   291 IINSFAEHNFVAKAHGSPRVYWLGLNDRAQEG-DW-RWLDGSPVTLSFWEPEEPNNIHDEDCATM 353

  Fly   213 NSNEMYFE-NCANDNYFACQ 231
            |....:.: :|....|:.|:
Human   354 NKGGTWNDLSCYKTTYWICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 29/102 (28%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
CLECT_DC-SIGN_like 254..374 CDD:153060 31/123 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.