DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and lectin-37Da

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster


Alignment Length:155 Identity:34/155 - (21%)
Similarity:59/155 - (38%) Gaps:27/155 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 QQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEI 160
            |...||...|.|:..||:       :..:|:..|.|:.|..||:.||::...|......:|.:.|
  Fly    29 QNGNPYNLTVDMTPFIKI-------NESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAI 86

  Fly   161 F----SEETKKKYWVDINSRANDGAS-WISTLSGRDVPFLKWKPNLATNI--HNHCVYIN----- 213
            .    :...:.::|...|.....|.. |.|  :.:.|...:|.|....|.  ..||:::.     
  Fly    87 AAFLNARGDRSEHWTSGNDLGKTGTHYWFS--NAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGY 149

  Fly   214 SNEMYFENCANDNY------FACQA 232
            |.|....:....|:      :.|:|
  Fly   150 STEFQLNDRPCHNHASSLFKYICEA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 23/117 (20%)
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 25/125 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.