DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and CG15358

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster


Alignment Length:256 Identity:75/256 - (29%)
Similarity:111/256 - (43%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFSIFALWNFWGVSAKK------QDTSTGTNEL---PKAPMPYYTIENIDMHQQHWFTYNSLRQN 63
            :.::|| ||....||..      ||......|.   ..:||    :::|..|:..| |.:.|:.|
  Fly     9 LLALFA-WNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPM----LDHIARHEGEW-TSSVLQAN 67

  Fly    64 GTLWRIGNME------------------QRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNK 110
            .|..|:..:|                  :.:..||...::|....||.|.          |...|
  Fly    68 ATEARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRILS----------KFDRK 122

  Fly   111 IKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKK-YWVDIN 174
            |....|:.||||.||:|.:.:..|.||...|||||..||.|...:||..:.::..|:: ||:||.
  Fly   123 IVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDIT 187

  Fly   175 SRANDGASWISTLSGRDVPFLKWKPNLATNI--HNHCVYINSNEMYFENCANDNYFACQAE 233
            ....:|...||. ||:...||||:.....|.  :.|||.:....||...|.:.:||.||::
  Fly   188 DLEKEGDFRISA-SGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQSD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 36/102 (35%)
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 36/104 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.