DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and CG2839

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster


Alignment Length:223 Identity:67/223 - (30%)
Similarity:103/223 - (46%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IENIDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENV--K 106
            :|||...|:..:|.|        :||.|..|.:..|::..|...:.:|:|||.::|.:..::  |
  Fly    53 LENISEQQKEGYTAN--------FRIFNETQGILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAK 109

  Fly   107 MSNKI-KMSV-----------------------------FKKIGSRHFYLEKQKKMPWDSAYDTC 141
            |..|: |:|:                             |:|:|||.||:|:..|..|..|...|
  Fly   110 MEIKVKKLSLEKSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKC 174

  Fly   142 RQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIH 206
            |:||||||:..:|:||:.|..:...:.||:|: |...|...:||.:||...|||||........:
  Fly   175 REMGGHLASPQNEEELHLISQKLDTESYWLDL-SDLTDHGQYISLVSGSKAPFLKWNKGQPNREN 238

  Fly   207 NHCVYINSNEMYFENCANDNYFACQAEQ 234
            ..||.:.........|.:...|.|||.|
  Fly   239 AQCVRVKGGLYQTFQCDHRVLFICQANQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 33/99 (33%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 41/116 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448762
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.