DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and CG12111

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster


Alignment Length:142 Identity:40/142 - (28%)
Similarity:67/142 - (47%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKK----- 168
            ::|..:.|.:||..::|:|...|:.|..|...||.|..|||:|.|:.|: |...:..|.|     
  Fly    41 SEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEM-EALIKYMKAKGFKNN 104

  Fly   169 --YWVDINSRANDGA-SWISTLSGRDVPFLKWK------PNLATNIHNHCVYI-NSNEMYFE-NC 222
              :|:..|....:|| .|:|  :||.:.:..|.      .|...|  .:||:: .:.||..: ||
  Fly   105 DYFWISGNDLGTEGAFYWMS--NGRPMTYAPWNGPKQMPDNYGGN--ENCVHMFATREMINDANC 165

  Fly   223 ANDNYFACQAEQ 234
            .....:.|:|.:
  Fly   166 KIQMLYVCEATE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 32/115 (28%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 34/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.