DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Klrb1b

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_775414.2 Gene:Klrb1b / 25192 RGDID:2975 Length:223 Species:Rattus norvegicus


Alignment Length:126 Identity:28/126 - (22%)
Similarity:53/126 - (42%) Gaps:26/126 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 HFYLEK-----QKKMPWDSAYDTCRQMGGHLANILDEKELNEI--FSEETKKKYWVDINSRANDG 180
            |.:.:|     |..:.|..:...|...|..|..:.|::||..:  .::.....:|:.::...:|.
  Rat    99 HSHQDKCFHVSQTSITWKGSLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDE 163

  Fly   181 A-SWI--STLSGRDVPFLKWKPNLATNI-----HNHCVYINSNEMYFENCANDNYFACQAE 233
            . .||  |||:..           |.||     .:.|..::.:::..|:|.:||.:.||.|
  Rat   164 KWKWINGSTLNSD-----------ALNITGDTEKDSCASVSQDKVLSESCDSDNIWICQKE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 22/109 (20%)
Klrb1bNP_775414.2 ITIM motif 5..10
LCK-binding motif. /evidence=ECO:0000250|UniProtKB:P27812 31..34
CLECT_NK_receptors_like 94..212 CDD:153063 26/123 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.