DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Klrk1

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_006237135.1 Gene:Klrk1 / 24934 RGDID:3180 Length:229 Species:Rattus norvegicus


Alignment Length:100 Identity:26/100 - (26%)
Similarity:45/100 - (45%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 WDSAYDTCRQMGGHLANILDEKELNEIFSEETKKKYWVD-INSRANDGASWI--STLSGRDVPFL 195
            |:.:..:|......|..|..::|  :.|.:..|..:|:. :.|.||....|.  |:||..::..:
  Rat   133 WNQSQASCLSQNSSLLKIYSKEE--QDFLKLVKSYHWMGLVQSPANGSWQWEDGSSLSPNELTLV 195

  Fly   196 KWKPNLATNIHNHCVYINSNEMYFENCANDNYFAC 230
            |      |......||.:|.:.|.|:|:|.|.:.|
  Rat   196 K------TPSGTCAVYGSSFKAYTEDCSNPNTYIC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 25/99 (25%)
Klrk1XP_006237135.1 CLECT_NK_receptors_like 112..226 CDD:153063 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.