DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Clec3b

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_035736.2 Gene:Clec3b / 21922 MGIID:104540 Length:202 Species:Mus musculus


Alignment Length:107 Identity:24/107 - (22%)
Similarity:44/107 - (41%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 AYDTCRQMGGHLANILDEKELNEIF-----SEETKKKYWVDINSRANDGASWISTLSGRDVPFLK 196
            |.:.|...||.|.....|.|...:|     |.......|:.:|..|.:|| |:. ::|..:.:..
Mouse    94 ASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGA-WVD-MTGGLLAYKN 156

  Fly   197 WKPNLATNIH----NHCVYIN--SNEMYFE-NCANDNYFACQ 231
            |:..:.|...    .:|..::  :|..:|: .|.:...:.||
Mouse   157 WETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 22/105 (21%)
Clec3bNP_035736.2 CLECT_tetranectin_like 71..199 CDD:153066 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5445
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.