DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Sftpd

DIOPT Version :10

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:159 Identity:34/159 - (21%)
Similarity:67/159 - (42%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVF---KKIGSRHFYLEKQKKMPWDSAYDTCRQ 143
            :.:.|||. |:...|::|     |..|:..|.::|   :.:|.:.|.....:| |::.|.:.|:|
Mouse   225 ALRQQMEA-LKGKLQRLE-----VAFSHYQKAALFPDGRSVGDKIFRTADSEK-PFEDAQEMCKQ 282

  Fly   144 MGGHLA---NILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNI 205
            .||.||   :..:...:.::.:...|..: :.:.....:|.....|  |..:.:..|.|....|.
Mouse   283 AGGQLASPRSATENAAIQQLITAHNKAAF-LSMTDVGTEGKFTYPT--GEPLVYSNWAPGEPNNN 344

  Fly   206 --HNHCVYINSNEMYFEN-CANDNYFACQ 231
              ..:||.|.:|..:.:. |.......|:
Mouse   345 GGAENCVEIFTNGQWNDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 21/105 (20%)
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222
gly_rich_SclB <60..>219 CDD:468478
Surfac_D-trimer 223..267 CDD:286141 12/47 (26%)
CLECT_collectin_like 261..374 CDD:153061 23/117 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.