DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Clec11a

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_033157.1 Gene:Clec11a / 20256 MGIID:1298219 Length:328 Species:Mus musculus


Alignment Length:243 Identity:49/243 - (20%)
Similarity:97/243 - (39%) Gaps:52/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 STGTNELPK-APMPYYTIENI---------DMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQS 82
            |:..|..|. :|.|..|:..|         .:||.|      :|.:....|:..:.|.|. :|:.
Mouse    96 SSSPNPFPSPSPTPEDTVTYILGRLASLDAGLHQLH------VRLHVLDTRVVELTQGLR-QLRD 153

  Fly    83 FQNQMETKLRALKQ-QIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGG 146
            ..:.....::|||: |.....|:.::...:|   ..::|.:.|.|.:..:.. .:|...|:..||
Mouse   154 AASDTRDSVQALKEVQDRAEQEHGRLEGCLK---GLRLGHKCFLLSRDFETQ-AAAQARCKARGG 214

  Fly   147 HLANILDEKELNEI--FSEETKKKY----WVDINSRANDGASWISTLSGRDVPFLKW-------- 197
            .||...|.::::.:  :.......|    |:.::.|.::|.....  :|:.|.|..|        
Mouse   215 SLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFE--NGQRVSFFAWHRAFSLES 277

  Fly   198 --KPNLATN----------IHNHCVYINSNE--MYFENCANDNYFACQ 231
              :|:.||:          :..:||...|::  .:..:|....||.|:
Mouse   278 GAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVCE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 24/127 (19%)
Clec11aNP_033157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..111 5/14 (36%)
CLECT 182..326 CDD:295302 29/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5445
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.