DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and clec-146

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001254401.1 Gene:clec-146 / 175004 WormBaseID:WBGene00013008 Length:189 Species:Caenorhabditis elegans


Alignment Length:192 Identity:42/192 - (21%)
Similarity:82/192 - (42%) Gaps:37/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVF 116
            |..|.::.:|.      ..:.::....:||:|:.:.||::|.||:::....:.:.....:.|..:
 Worm    15 QTQFNFHGMRS------FFSTDEEFPTQLQNFEGRTETEIRTLKEKVARLEKLIDGLQSVLMKEW 73

  Fly   117 K--KIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKE----LNEIFSEETKKKYWVDINS 175
            .  :.||::...|::|.  ||:|...|:..|.|||.|.:|.:    .|.|.|.||....|:.:.:
 Worm    74 NTTESGSKYRLFEERKS--WDNAERHCQGFGAHLAIIDNEAKNGFVTNLINSSETSDFAWIGMKT 136

  Fly   176 RANDGASWISTLSGRDVPFLKWKPNLATNIHNH-----CVYINSNEMY-FENCANDNYFACQ 231
            :         |.:....||        ||..:.     |..:::..:: ..:|.....|.||
 Worm   137 K---------TTTQTSTPF--------TNFDSESPIDGCAVMDAKGVWSIRSCIQLRPFVCQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 24/109 (22%)
clec-146NP_001254401.1 CLECT 78..181 CDD:214480 28/121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.