DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Fcer2

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001029096.1 Gene:Fcer2 / 171075 RGDID:619997 Length:331 Species:Rattus norvegicus


Alignment Length:265 Identity:52/265 - (19%)
Similarity:81/265 - (30%) Gaps:91/265 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 HWFTYNSLRQNG--TLWRIGN---------------------MEQRLEMRLQSFQNQMETKLRAL 94
            ||.|..||:|.|  .:..:.:                     |.|.|| .||:.|.||:::...|
  Rat    48 HWETEKSLKQLGDAAIQNVSHVTKDLQNYQSNQLAQKSQALQMSQNLE-ELQAEQKQMKSQDSQL 111

  Fly    95 KQQIEPYME---NVKMSN----------------------------------------KIKMSVF 116
            .|.:....|   |||..|                                        |:.:.:.
  Rat   112 SQNLNELQEDLINVKSQNSELSQNLNTLQEDLVNVKSQGLNEKRAASDSLEKLQEEVAKLWIEIL 176

  Fly   117 KKIGSR---------HF----YLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKK 168
            ...|:.         ||    |...:....|..|..||..:.|.|.:|..:||.:.:.....||:
  Rat   177 MSKGTACNVCPKDWLHFQQKCYYFGEGSKQWIQAKFTCSDLEGRLVSIHSQKEQDFLMQHINKKE 241

  Fly   169 YWVDINSRANDGA-SWISTLSGRDVPFLKWKPNLATN--IHNHCVYINSNEMYFENCANDNYFAC 230
            .|:.:.....:|. .|   ..|..|.:..|.|....|  ....||.:..:..:     ||.:...
  Rat   242 SWIGLQDLNMEGEFVW---PDGSPVGYSNWSPGEPNNGGQGEDCVMMRGSGQW-----NDAFCRS 298

  Fly   231 QAEQW 235
            ..:.|
  Rat   299 YLDAW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 23/102 (23%)
Fcer2NP_001029096.1 RILP-like <60..170 CDD:304877 16/110 (15%)
CLECT_DC-SIGN_like 186..306 CDD:153060 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.